[RDF data]
Home | All targets
PropertyValue
drugbank:bio2rdfSymbol <http://symbol.bio2rdf.org/symbol:ZNF123>
drugbank:cellularLocation nucleus
drugbank:chromosomeLocation 11
drugbank:drugReference <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/references/17016423>
drugbank:drugReference <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/references/17139284>
drugbank:essentiality Non-Essential
drugbank:genatlasId ZNF123
drugbank:genbankIdGene S52506
drugbank:genbankIdGenePage <http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=S52506>
drugbank:genbankIdProtein 263346
drugbank:genbankIdProteinPage <http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?val=263346>
drugbank:geneName ZNF123
drugbank:geneSequence >222 bp ACTGGAGAGAAGCCCTTTGCATGTAAGGGTTGCAAGAAGGCATTCGATCAGAAAATAACC CTGATTCAGCACGAGGGAGTTCACACTGGTGAGAAACCTTATGAGTGTAGAAGGTGTGGG AGCCCCTCAGCTGGTGTGGAAACTTCGTTATGCATCAGAAGCCACACACTCAAAAGGCAC CCATTTAAGCATAGGGCTAGCCACTATCAGGCTCACTACACC
drugbank:genecardId ZNF123
drugbank:generalReference <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/references/1339395>
drugbank:goClassificationComponent intracellular membrane-bound organelle
drugbank:goClassificationComponent membrane-bound organelle
drugbank:goClassificationComponent nucleus
drugbank:goClassificationComponent organelle
drugbank:goClassificationFunction binding
drugbank:goClassificationFunction cation binding
drugbank:goClassificationFunction ion binding
drugbank:goClassificationFunction nucleic acid binding
drugbank:goClassificationFunction transition metal ion binding
drugbank:goClassificationFunction zinc ion binding
drugbank:hgncId <http://bio2rdf.org/hgnc:12906>
drugbank:hgncIdPage <http://www.genenames.org/data/hgnc_data.php?hgnc_id=12906>
rdfs:label Zinc finger protein 123
drugbank:locus 11q23.1-q23.2
drugbank:molecularWeight 8382
drugbank:name Zinc finger protein 123
drugbank:numberOfResidues 75
drugbank:pfamDomainFunction <http://bio2rdf.org/pfam:PF00096>
drugbank:pfamDomainFunctionPage <http://pfam.sanger.ac.uk/family?acc=PF00096>
drugbank:proteinSequence >Zinc finger protein 123 TGEKPFACKGCKKAFDQKITLIQHEGVHTGEKPYECRRCGSPSAGVETSLCIRSHTLKRH PFKHRASHYQAHYT
owl:sameAs <http://www.dbpedia.org/resource/ZNF3>
drugbank:specificFunction May act as a transcription regulator in developmental processes
drugbank:swissprotId <http://bio2rdf.org/uniprot:P35273>
drugbank:swissprotName ZN123_HUMAN
drugbank:swissprotPage <http://www.uniprot.org/uniprot/P35273>
drugbank:synonym HZF-1
is drugbank:target of <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugs/DB00013>
drugbank:theoreticalPi 9.68
rdf:type drugbank:targets