[RDF data]
Home | All drugs
PropertyValue
drugbank:ahfsCode 20:16.00
drugbank:atcCode L03AA02
drugbank:atcCode L03AA13
drugbank:brandName Neupogen (Amgen Inc.)
drugbank:brandedDrug <http://wifo5-04.informatik.uni-mannheim.de/dailymed/resource/drugs/2304>
drugbank:casRegistryNumber <http://bio2rdf.org/cas:143011-72-7>
drugbank:chemicalFormula C845H1343N223O243S9
drugbank:chemicalIupacName Human granulocyte colony stimulating factor
drugbank:chemicalStructure >DB00099 sequence MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWA PLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQ QMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
drugbank:contraindicationInsert <http://129.128.185.122/drugbank2/drugs/DB00099/inserts/1149/full>
drugbank:creationDate 2005-06-13 13:24:05 UTC
drugbank:description Recombinant human G-CSF (Granulocyte colony stimulating factor), 175 residues, expressed in E. coli. The protein has an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis, except for the addition of an N-terminal methionine necessary for expression in E coli.
drugbank:dosageForm <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/dosageforms/solutionIntravenous>
drugbank:dpdDrugIdNumber 01968017
drugbank:drugCategory <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugcategory/anti-infectiveAgents>
drugbank:drugCategory <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugcategory/antineutropenicAgents>
drugbank:drugCategory <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugcategory/immunomodulatoryAgents>
drugbank:drugIdNumberPage <http://205.193.93.51/dpdonline/searchRequest.do?din=01968017>
drugbank:drugType <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugtype/approved>
drugbank:drugType <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/drugtype/biotech>
drugbank:experimentalLogpHydrophobicity 0.209
drugbank:fdaLabelFiles 2004-03-01 /drugs/99/fda_labels/1025
drugbank:genbankId X03438
drugbank:genericName Filgrastim
drugbank:indication Increases leukocyte production, for treatment in non-myeloid cancer,neutropenia and bone marrow transplant
drugbank:interactionInsert <http://129.128.185.122/drugbank2/drugs/DB00099/inserts/2156/full>
rdfs:label Filgrastim
drugbank:limsDrugId 99
drugbank:massSpecFile 0
drugbank:mechanismOfAction Filgrastim binds to the G-CSF receptor. As a G-CSF analog, it controls proliferation of committed progenitor cells and influences their maturation into mature neutrophils. Filgrastim also stimulates the release of neutrophils from bone marrow storage pools and reduces their maturation time. Filgrastim acts to increase the phagocytic activity of mature neutrophils. In patients receiving cytotoxic chemotherapy, Filgrastim can accelerate neutrophil recovery, leading to a reduction in duration of the neutropenic phase
drugbank:meltingPoint 60 oC (Luo, P., Protein Science 11:1218-1226 (2002))
drugbank:molecularWeightAverage 18802.8
foaf:page <http://dbpedia.org/page/Filgrastim>
foaf:page <http://en.wikipedia.org/wiki/Filgrastim>
foaf:page <http://www.drugbank.ca/drugs/DB00099>
drugbank:patientInformationInsert http://129.128.185.122/drugbank2/drugs/DB00099/inserts/307/full
drugbank:pdbExperimentalId 1PGR
drugbank:pharmacology Used in the treatment of chemotherapy-induced neutropenia by enhancing the production of neutrophils. Filgrastim acts on hematopoietic cells by binding to specific cell surface receptors thereby stimulating proliferation, differentiation, commitment, and end cell functional activation.
drugbank:pharmgkbId PA449626
drugbank:pkaIsoelectricPoint 5.65
drugbank:possibleDiseaseTarget <http://wifo5-04.informatik.uni-mannheim.de/diseasome/resource/diseases/2550>
drugbank:possibleDiseaseTarget <http://wifo5-04.informatik.uni-mannheim.de/diseasome/resource/diseases/3366>
drugbank:possibleDiseaseTarget <http://wifo5-04.informatik.uni-mannheim.de/diseasome/resource/diseases/493>
drugbank:possibleDiseaseTarget <http://wifo5-04.informatik.uni-mannheim.de/diseasome/resource/diseases/833>
drugbank:primaryAccessionNo DB00099
drugbank:reference
drugbank:rxlistLink <http://www.rxlist.com/cgi/generic/filgrastim.htm>
owl:sameAs <http://data.linkedct.org/resource/intervention/17515>
owl:sameAs <http://data.linkedct.org/resource/intervention/28135>
owl:sameAs <http://data.linkedct.org/resource/intervention/28141>
owl:sameAs <http://data.linkedct.org/resource/intervention/28142>
owl:sameAs <http://data.linkedct.org/resource/intervention/28144>
owl:sameAs <http://data.linkedct.org/resource/intervention/28145>
owl:sameAs <http://data.linkedct.org/resource/intervention/28285>
owl:sameAs <http://data.linkedct.org/resource/intervention/28288>
owl:sameAs <http://data.linkedct.org/resource/intervention/37597>
owl:sameAs <http://data.linkedct.org/resource/intervention/38086>
owl:sameAs <http://data.linkedct.org/resource/intervention/38087>
owl:sameAs <http://data.linkedct.org/resource/intervention/38460>
owl:sameAs <http://data.linkedct.org/resource/intervention/38962>
owl:sameAs <http://data.linkedct.org/resource/intervention/38974>
owl:sameAs <http://data.linkedct.org/resource/intervention/39004>
owl:sameAs <http://data.linkedct.org/resource/intervention/44025>
owl:sameAs <http://data.linkedct.org/resource/intervention/44172>
owl:sameAs <http://data.linkedct.org/resource/intervention/53143>
owl:sameAs <http://data.linkedct.org/resource/intervention/5519>
owl:sameAs <http://data.linkedct.org/resource/intervention/5800>
owl:sameAs <http://data.linkedct.org/resource/intervention/58295>
owl:sameAs <http://dbpedia.org/resource/Filgrastim>
owl:sameAs <http://www.dbpedia.org/resource/Filgrastim>
owl:sameAs <http://www.dbpedia.org/resource/Lenograstim>
drugbank:secondaryAccessionNumber biod00072
drugbank:secondaryAccessionNumber btd00072
drugbank:state Liquid
drugbank:structure 0
drugbank:swissprotId <http://bio2rdf.org/uniprot:P09919>
drugbank:swissprotName CSF3_HUMAN
drugbank:swissprotPage <http://www.uniprot.org/uniprot/P09919>
drugbank:synonym G-CSF
drugbank:synonym Granulocyte colony-stimulating factor precursor
drugbank:synonym Lenograstim
drugbank:synonym Pluripoietin
drugbank:target <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/targets/437>
drugbank:target <http://wifo5-04.informatik.uni-mannheim.de/drugbank/resource/targets/870>
rdf:type drugbank:drugs
rdf:type vocabClass:Offer
drugbank:updateDate 2007-10-22 02:38:51 UTC